Structure of PDB 2i0l Chain B Binding Site BS01

Receptor Information
>2i0l Chain B (length=83) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIG
DKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i0l Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		L328 F330 S331 I332 N338 T350 H383 L390
Binding residue
(residue number reindexed from 1)		L11 F13 S14 I15 N21 T33 H66 L73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2i0l, PDBe:2i0l, PDBj:2i0l
PDBsum2i0l
PubMed17267502
UniProtQ62696|DLG1_RAT Disks large homolog 1 (Gene Name=Dlg1)

[Back to BioLiP]