Structure of PDB 2hzv Chain B Binding Site BS01

Receptor Information
>2hzv Chain B (length=131) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGT
QGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAV
LKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hzv NikR-operator complex structure and the mechanism of repressor activation by metal ions.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R3 N27 R28 S29 R33 R65
Binding residue
(residue number reindexed from 1)		R3 N27 R28 S29 R33 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016151 nickel cation binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010045 response to nickel cation
GO:2000143 negative regulation of DNA-templated transcription initiation
Cellular Component
GO:0005667 transcription regulator complex
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hzv, PDBe:2hzv, PDBj:2hzv
PDBsum2hzv
PubMed16945905
UniProtP0A6Z6|NIKR_ECOLI Nickel-responsive regulator (Gene Name=nikR)

[Back to BioLiP]