Structure of PDB 2hwn Chain B Binding Site BS01

Receptor Information
>2hwn Chain B (length=45) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
Ligand information
>2hwn Chain E (length=19) Species: 9541 (Macaca fascicularis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EELAWKIAKMIVSDVMQQC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hwn A Dynamic Mechanism for AKAP Binding to RII Isoforms of cAMP-Dependent Protein Kinase.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		I3 L13 T17
Binding residue
(residue number reindexed from 1)		I4 L14 T18
Enzymatic activity
Enzyme Commision number 2.7.11.11: cAMP-dependent protein kinase.
External links
PDB RCSB:2hwn, PDBe:2hwn, PDBj:2hwn
PDBsum2hwn
PubMed17081990
UniProtP12368|KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit (Gene Name=Prkar2a)

[Back to BioLiP]