Structure of PDB 2huw Chain B Binding Site BS01

Receptor Information

>2huw Chain B (length=98) Species: 9606 (Homo sapiens)

KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDV
QHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ

Ligand information

• Ligand ID: YVN
• InChI: InChI=1S/C21H30N5O9P/c1-9(2)17(21(31)25-12(18(23)28)8-13(22)27)26-20(30)16-14(15(16)19(29)24-3)10-4-6-11(7-5-10)35-36(32,33)34/h4-7,9,12,14-17H,8H2,1-3H3,(H2,22,27)(H2,23,28)(H,24,29)(H,25,31)(H,26,30)(H2,32,33,34)/t12-,14-,15+,16+,17-/m0/s1
• InChIKey: LVYNAUCEOQBVSW-RDDKANTKSA-N
• SMILES:
  ACDLabs 10.04: O=C(N)CC(C(=O)N)NC(=O)C(NC(=O)C2C(C(=O)NC)C2c1ccc(OP(=O)(O)O)cc1)C(C)C
  CACTVS 3.341: CNC(=O)[CH]1[CH]([CH]1c2ccc(O[P](O)(O)=O)cc2)C(=O)N[CH](C(C)C)C(=O)N[CH](CC(N)=O)C(N)=O
  OpenEye OEToolkits 1.5.0: CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N)NC(=O)[C@@H]1[C@H]([C@H]1C(=O)NC)c2ccc(cc2)OP(=O)(O)O
  OpenEye OEToolkits 1.5.0: CC(C)C(C(=O)NC(CC(=O)N)C(=O)N)NC(=O)C1C(C1C(=O)NC)c2ccc(cc2)OP(=O)(O)O
  CACTVS 3.341: CNC(=O)[C@H]1[C@@H]([C@H]1c2ccc(O[P](O)(O)=O)cc2)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(N)=O
• Formula: C21 H30 N5 O9 P
• Name: N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide
• ZINC: ZINC000016052137
• PDB chain: 2huw Chain B Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2huw Ligand Preorganization May Be Accompanied by Entropic Penalties in Protein-Ligand Interactions.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): R67 R86 S88 E89 S90 S96 Q106 H107 F108 K109 L120 W121
• Binding residue (residue number reindexed from 1): R12 R31 S33 E34 S35 S41 Q51 H52 F53 K54 L65 W66
• Annotation score: 1
• Binding affinity: MOAD: Ka=1000000M^-1

External links

• PDB: RCSB:2huw, PDBe:2huw, PDBj:2huw
• PDBsum: 2huw
• PubMed: 17001728
• UniProt: P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)