Structure of PDB 2hqh Chain B Binding Site BS01

Receptor Information
>2hqh Chain B (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQG
RKYFTCDEGHGIFVRQSQIQVF
Ligand information
>2hqh Chain E (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PYCEICEMFGHWATNCNDDETF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hqh CLIP170 autoinhibition mimics intermolecular interactions with p150Glued or EB1.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		I36 G37 K38 Q93 Q95
Binding residue
(residue number reindexed from 1)		I11 G12 K13 Q68 Q70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2hqh, PDBe:2hqh, PDBj:2hqh
PDBsum2hqh
PubMed17828275
UniProtQ14203|DCTN1_HUMAN Dynactin subunit 1 (Gene Name=DCTN1)

[Back to BioLiP]