Structure of PDB 2hdx Chain B Binding Site BS01

Receptor Information
>2hdx Chain B (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFN
FQGKAKHLRLSLNAAGQCRVQHLHFQSIFDMLEHFRVHPIPLESSDVVLV
SYVPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hdx Structural Basis for Phosphotyrosine Recognition by the Src Homology-2 Domains of the Adapter Proteins SH2-B and APS.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R534 R555 K575 H576 R578 Q590 H591 P610 L611 E612
Binding residue
(residue number reindexed from 1)		R15 R36 K56 H57 R59 Q71 H72 P91 L92 E93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035591 signaling adaptor activity
Biological Process
GO:0007165 signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2hdx, PDBe:2hdx, PDBj:2hdx
PDBsum2hdx
PubMed16824542
UniProtQ91ZM2|SH2B1_MOUSE SH2B adapter protein 1 (Gene Name=Sh2b1)

[Back to BioLiP]