Structure of PDB 2hdd Chain B Binding Site BS01

Receptor Information
>2hdd Chain B (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKN
KRAKIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hdd Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y25 R31 K46 K50 R53 K57
Binding residue
(residue number reindexed from 1)		Y24 R30 K45 K49 R52 K56
Binding affinityPDBbind-CN: Kd=8.8pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2hdd, PDBe:2hdd, PDBj:2hdd
PDBsum2hdd
PubMed9309220
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]