Structure of PDB 2h8b Chain B Binding Site BS01

Receptor Information
>2h8b Chain B (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTPEMREKLCGHHFVRALVRVCGGPRWSTEA
Ligand information
>2h8b Chain A (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAATNPARYCCLSGCTQQDLLTLCPY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h8b Solution Structure and Characterization of the LGR8 Receptor Binding Surface of Insulin-like Peptide 3
ResolutionN/A
Binding residue
(original residue number in PDB)		P1 E4 R6 E7 K8 L9 C10 F14 A17 V21 C22 R26 W27
Binding residue
(residue number reindexed from 1)		P1 E4 R6 E7 K8 L9 C10 F14 A17 V21 C22 R26 W27
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2h8b, PDBe:2h8b, PDBj:2h8b
PDBsum2h8b
PubMed16867980
UniProtP51460|INSL3_HUMAN Insulin-like 3 (Gene Name=INSL3)

[Back to BioLiP]