Structure of PDB 2h65 Chain B Binding Site BS01

Receptor Information
>2h65 Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHI
LTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h65 Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y204 S205 W206 R207 N208 S209 W214 S249 F250
Binding residue
(residue number reindexed from 1)
Y19 S20 W21 R22 N23 S24 W29 S64 F65
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2h65, PDBe:2h65, PDBj:2h65
PDBsum2h65
PubMed16781734
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]