Structure of PDB 2h59 Chain B Binding Site BS01

Receptor Information

>2h59 Chain B (length=246) Species: 2336 (Thermotoga maritima)

MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDI
DFFYSHPEEFYRFAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNI
DRLHQRAGSKKVIELAGNVEEYYCVRCEKKYTVEDVIKKLESSDVPLCDD
CNSLIRPNIVFFGENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELP
LITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGIS

Ligand information

>2h59 Chain E (length=6) Species: 9606 (Homo sapiens)

HKKLMF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2h59 Insights into the Sirtuin Mechanism from Ternary Complexes Containing NAD(+) and Acetylated Peptide.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): R34 Q45 V160 F162 G163 E164 N165 L166 V192 V193 Y194
• Binding residue (residue number reindexed from 1): R34 Q45 V160 F162 G163 E164 N165 L166 V192 V193 Y194

Enzymatic activity

• Catalytic site (original residue number in PDB): P31 D32 F33 R34 N99 D101 A116
• Catalytic site (residue number reindexed from 1): P31 D32 F33 R34 N99 D101 A116
• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0016740 transferase activity
• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0034979 NAD-dependent protein lysine deacetylase activity
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006476 protein deacetylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2h59, PDBe:2h59, PDBj:2h59
• PDBsum: 2h59
• PubMed: 16905097
• UniProt: Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase (Gene Name=cobB)