Structure of PDB 2h51 Chain B Binding Site BS01

Receptor Information
>2h51 Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVE
EIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h51 An allosteric circuit in caspase-1.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
S339 W340 R341 H342 R383
Binding residue
(residue number reindexed from 1)
S22 W23 R24 H25 R66
Enzymatic activity
Catalytic site (original residue number in PDB) D390
Catalytic site (residue number reindexed from 1) D73
Enzyme Commision number 3.4.22.36: caspase-1.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2h51, PDBe:2h51, PDBj:2h51
PDBsum2h51
PubMed18590738
UniProtP29466|CASP1_HUMAN Caspase-1 (Gene Name=CASP1)

[Back to BioLiP]