Structure of PDB 2h3a Chain B Binding Site BS01

Receptor Information
>2h3a Chain B (length=72) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQE
GMVEVARFIEMNGSFADENKDW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h3a Structural Basis for Nucleic Acid and Toxin Recognition of the Bacterial Antitoxin CcdA
ResolutionN/A
Binding residue
(original residue number in PDB)		K102 R104 Y114 N123 S125 E160 S164 F165
Binding residue
(residue number reindexed from 1)		K2 R4 Y14 N23 S25 E60 S64 F65
Binding affinityPDBbind-CN: Kd=149uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0032984 protein-containing complex disassembly
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0017053 transcription repressor complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2h3a, PDBe:2h3a, PDBj:2h3a
PDBsum2h3a
PubMed17007877
UniProtP62552|CCDA_ECOLI Antitoxin CcdA (Gene Name=ccdA)

[Back to BioLiP]