Structure of PDB 2h1k Chain B Binding Site BS01

Receptor Information
>2h1k Chain B (length=60) Species: 10036 (Mesocricetus auratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQ
NRRMKWKKEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h1k Structural basis for induced fit mechanisms in DNA recognition by the pdx1 homeodomain
Resolution2.42 Å
Binding residue
(original residue number in PDB)		R5 Y25 R31 Q50 R53 M54
Binding residue
(residue number reindexed from 1)		R5 Y25 R31 Q50 R53 M54
Binding affinityPDBbind-CN: Kd=1.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2h1k, PDBe:2h1k, PDBj:2h1k
PDBsum2h1k
PubMed17315980
UniProtP70118|PDX1_MESAU Pancreas/duodenum homeobox protein 1 (Gene Name=PDX1)

[Back to BioLiP]