Structure of PDB 2gsi Chain B Binding Site BS01

Receptor Information
>2gsi Chain B (length=210) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQQSGAELVRSGASVKLSCTASGFNIKDYYMYWVKLRPEQGLEWIGWI
DPENGDTEYVPTFQGKVTMTADTSSNTAYLQLSSLTSEDTAVYYCNAGVI
TMAMDYWGQGTTVTTSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVT
WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASS
TKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gsi Crystal Structure of a Murine Fab in Complex with an 11 Residue Peptide Derived from Staphylococcal Nuclease
Resolution2.81 Å
Binding residue
(original residue number in PDB)
Y33 Y35 W50 D52 E53 E58 V96 I97 T98 M99
Binding residue
(residue number reindexed from 1)
Y32 Y34 W49 D51 E53 E58 V99 I100 T101 M102
Enzymatic activity
Enzyme Commision number ?
External links