Structure of PDB 2gii Chain B Binding Site BS01

Receptor Information

>2gii Chain B (length=227) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFIKPIYQDINSILIEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPA
IIGHEARYKLFNSPTLLFLLSRGKAATENWSLFEEKQNDTADILLVKDQF
YELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKEFDLFDINYLEVD
WECVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKS
YLKHFVTQAEQRAISMIDKFVKPFKKY

Ligand information

>2gii Chain E (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccggttaaccggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2gii Alteration of Sequence Specificity of the Type II Restriction Endonuclease HincII through an Indirect Readout Mechanism.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	Q109 K135 F138 N141 S144 A205 M206
Binding residue (residue number reindexed from 1)	Q87 K113 F116 N119 S122 A176 M177
Binding affinity	PDBbind-CN: Kd=0.42nM

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2gii, PDBe:2gii, PDBj:2gii
PDBsum	2gii
PubMed	16675462
UniProt	P17743\|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]