Structure of PDB 2ght Chain B Binding Site BS01

Receptor Information
>2ght Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQ
VYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARL
FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWF
DNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ght Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
N96 L97 D98 F106 I120 D121 T152 A153 S154 L155 K157 Y158 R178 N187 Y188 S208
Binding residue
(residue number reindexed from 1)
N20 L21 D22 F30 I44 D45 T76 A77 S78 L79 K81 Y82 R102 N111 Y112 S132
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Gene Ontology
Molecular Function
GO:0016791 phosphatase activity

View graph for
Molecular Function
External links
PDB RCSB:2ght, PDBe:2ght, PDBj:2ght
PDBsum2ght
PubMed17157258
UniProtQ9GZU7|CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (Gene Name=CTDSP1)

[Back to BioLiP]