Structure of PDB 2geq Chain B Binding Site BS01

Receptor Information
>2geq Chain B (length=189) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKTYQGNYGFHLGFLQSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAG
SRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPE
YLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTI
ITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2geq Structure of the p53 Core Domain Dimer Bound to DNA.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S238 R270 A273 R277
Binding residue
(residue number reindexed from 1)		S137 R169 A172 R176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2geq, PDBe:2geq, PDBj:2geq
PDBsum2geq
PubMed16717092
UniProtP02340|P53_MOUSE Cellular tumor antigen p53 (Gene Name=Tp53)

[Back to BioLiP]