Structure of PDB 2g5l Chain B Binding Site BS01

Receptor Information
>2g5l Chain B (length=105) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITGTWYNQLGSTFIVTAGADGALTGTYYVLTGRYDSAPATDGSGTALGW
TVAWKNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDT
FTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g5l High resolution structure of Streptavidin in complex with a novel high affinity peptide tag mimicking the biotin binding motif
Resolution1.15 Å
Binding residue
(original residue number in PDB)		S27 Y43 Y54 W79 S88 T90 W108 L110 S112 H127 D128
Binding residue
(residue number reindexed from 1)		S12 Y28 Y29 W54 S59 T61 W79 L81 S83 H98 D99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2g5l, PDBe:2g5l, PDBj:2g5l
PDBsum2g5l
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]