Structure of PDB 2g4m Chain B Binding Site BS01

Receptor Information
>2g4m Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g4m On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Binding residue
(residue number reindexed from 1)		V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2g4m, PDBe:2g4m, PDBj:2g4m
PDBsum2g4m
PubMed17327674
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]