Structure of PDB 2f9j Chain B Binding Site BS01

Receptor Information

>2f9j Chain B (length=114) Species: 9606 (Homo sapiens)

RLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAY
VVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLK
LLKEKYGINTDPPK

Ligand information

>2f9j Chain Q (length=27) Species: 9606 (Homo sapiens)

EREIDERNRPLSDEELDAMFPEGYKVL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2f9j Crystal structure of a core spliceosomal protein interface
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): L13 P14 P15 V17 R19 I20 A32 R46 Q47 I48 R49 V50 G51 N52 T56 T59 Y61 D66 I67 Y92 A97 F98 L113 Y117
• Binding residue (residue number reindexed from 1): L2 P3 P4 V6 R8 I9 A21 R35 Q36 I37 R38 V39 G40 N41 T45 T48 Y50 D55 I56 Y81 A86 F87 L102 Y106

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0001825 blastocyst formation
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0005689 U12-type spliceosomal complex
• GO:0071011 precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:2f9j, PDBe:2f9j, PDBj:2f9j
• PDBsum: 2f9j
• PubMed: 16432215
• UniProt: Q9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 (Gene Name=SF3B6)