Structure of PDB 2ev6 Chain B Binding Site BS01

Receptor Information

>2ev6 Chain B (length=137) Species: 1423 (Bacillus subtilis)

PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLI
YEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEH
HLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHH

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2ev6 Chain B Residue 2151

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2ev6 Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): E11 H77 E102
• Binding residue (residue number reindexed from 1): E8 H74 E99
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding
• GO:0046914 transition metal ion binding
• GO:0046983 protein dimerization activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0030026 intracellular manganese ion homeostasis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2ev6, PDBe:2ev6, PDBj:2ev6
• PDBsum: 2ev6
• PubMed: 16533030
• UniProt: P54512|MNTR_BACSU HTH-type transcriptional regulator MntR (Gene Name=mntR)