Structure of PDB 2erg Chain B Binding Site BS01

Receptor Information
>2erg Chain B (length=65) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FACVECRQQKSKCDACERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEA
IEKRFKELTRTLTNL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2erg Structure of a Leu3-DNA complex: recognition of everted CGG half-sites by a Zn2Cys6 binuclear cluster protein.
Resolution3.15 Å
Binding residue
(original residue number in PDB)
Q43 K44 R75 Y77 K78 R79
Binding residue
(residue number reindexed from 1)
Q9 K10 R41 Y43 K44 R45
Binding affinityPDBbind-CN: Kd=25nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2erg, PDBe:2erg, PDBj:2erg
PDBsum2erg
PubMed16615914
UniProtP08638|LEUR_YEAST Regulatory protein LEU3 (Gene Name=LEU3)

[Back to BioLiP]