Structure of PDB 2emt Chain B Binding Site BS01

Receptor Information

>2emt Chain B (length=313) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYV
DSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQR
LFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLAND
RLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEM
YGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISF
NDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQARVDS

Ligand information

>2emt Chain D (length=17) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RLSRKTHMYPVRNYSPT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2emt Structural basis of PSGL-1 binding to ERM proteins
Resolution	2.8 Å
Binding residue (original residue number in PDB)	I245 R246 N247 I248 S249 F250 N251 D252 L274 M285 H288
Binding residue (residue number reindexed from 1)	I245 R246 N247 I248 S249 F250 N251 D252 L274 M285 H288

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0008092	cytoskeletal protein binding

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:2emt, PDBe:2emt, PDBj:2emt
PDBsum	2emt
PubMed	18076570
UniProt	P26043\|RADI_MOUSE Radixin (Gene Name=Rdx)

[Back to BioLiP]