Structure of PDB 2efa Chain B Binding Site BS01

Receptor Information

>2efa Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>2efa Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2efa A neutron crystallographic analysis of a cubic porcine insulin at pD 6.6
Resolution	2.7 Å
Binding residue (original residue number in PDB)	V2 Q4 H5 L6 C7 L11 L15 C19 R22 G23 F24 F25 P28 A30
Binding residue (residue number reindexed from 1)	V2 Q4 H5 L6 C7 L11 L15 C19 R22 G23 F24 F25 P28 A30

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2efa, PDBe:2efa, PDBj:2efa
PDBsum	2efa
PubMed
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]