Structure of PDB 2e7l Chain B Binding Site BS01

Receptor Information
>2e7l Chain B (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYS
GDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSHQGRYLTF
GSGTKVIVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2e7l How a single T cell receptor recognizes both self and foreign MHC.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
Y31 Q100 G101
Binding residue
(residue number reindexed from 1)
Y30 Q94 G95
Enzymatic activity
Enzyme Commision number ?
External links