Structure of PDB 2e74 Chain B Binding Site BS01

Receptor Information

>2e74 Chain B (length=160) Species: 83541 (Mastigocladus laminosus)

MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFAC
IVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLL
MASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFP
LDKTLTLGLF

Ligand information

>2e74 Chain H (length=29) Species: 83541 (Mastigocladus laminosus)

MEIDVLGWVALLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2e74 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): C50 L57
• Binding residue (residue number reindexed from 1): C50 L57

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E78

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:2e74, PDBe:2e74, PDBj:2e74
• PDBsum: 2e74
• PubMed: 17498743
• UniProt: P83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)