Structure of PDB 2e3k Chain B Binding Site BS01

Receptor Information
>2e3k Chain B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMD
LSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDV
FEFRYAKMPD
Ligand information
>2e3k Chain Q (length=15) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGRGKGGKGLGKGGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2e3k Structural basis for diacetylated histone H4 tail recognition by the second bromodomain of human BRD2
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F372 V376 C425 Y428 N429 P430 H433 D434
Binding residue
(residue number reindexed from 1)		F27 V31 C80 Y83 N84 P85 H88 D89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2e3k, PDBe:2e3k, PDBj:2e3k
PDBsum2e3k
PubMed
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]