Structure of PDB 2ds8 Chain B Binding Site BS01

Receptor Information
>2ds8 Chain B (length=41) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ds8 Structural Basis of SspB-tail Recognition by the Zinc Binding Domain of ClpX.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Q21 V24 R25 K26 L27 I28 A29 Y34
Binding residue
(residue number reindexed from 1)		Q12 V15 R16 K17 L18 I19 A20 Y25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:2ds8, PDBe:2ds8, PDBj:2ds8
PDBsum2ds8
PubMed17258768
UniProtP0A6H1|CLPX_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpX (Gene Name=clpX)

[Back to BioLiP]