Structure of PDB 2dko Chain B Binding Site BS01

Receptor Information
>2dko Chain B (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLK
QYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELY
FYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dko Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
Resolution1.06 Å
Binding residue
(original residue number in PDB)		Y204 S205 W206 R207 S249 F250
Binding residue
(residue number reindexed from 1)		Y30 S31 W32 R33 S75 F76
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2dko, PDBe:2dko, PDBj:2dko
PDBsum2dko
PubMed16787777
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]