Structure of PDB 2df6 Chain B Binding Site BS01

Receptor Information
>2df6 Chain B (length=59) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGW
FPSNYVREI
Ligand information
>2df6 Chain C (length=18) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPVIAPRPEHTKSIYTRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2df6 Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
Resolution1.3 Å
Binding residue
(original residue number in PDB)		N16 F17 Q18
Binding residue
(residue number reindexed from 1)		N12 F13 Q14
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2df6, PDBe:2df6, PDBj:2df6
PDBsum2df6
PubMed16527308
UniProtO55043|ARHG7_RAT Rho guanine nucleotide exchange factor 7 (Gene Name=Arhgef7)

[Back to BioLiP]