Structure of PDB 2d5v Chain B Binding Site BS01

Receptor Information
>2d5v Chain B (length=135) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWS
KLKSGRETFRRMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENK
RPSKELQITISQQLGLELSTVSNFFMNARRRSLDK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d5v DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R34 S35 G37 T38 K47 K51 L52 K53 G55 T58 P100 R101 K124 R150
Binding residue
(residue number reindexed from 1)		R34 S35 G37 T38 K47 K51 L52 K53 G55 T58 P80 R81 K104 R130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2d5v, PDBe:2d5v, PDBj:2d5v
PDBsum2d5v
PubMed17223534
UniProtP70512|HNF6_RAT Hepatocyte nuclear factor 6 (Gene Name=Onecut1)

[Back to BioLiP]