Structure of PDB 2c7a Chain B Binding Site BS01

Receptor Information

>2c7a Chain B (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVD
KIRRKNCPACRLRKCCQAGMVLGGRK

Ligand information

>2c7a Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccagaacagtttgttctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2c7a Structure of the Progesterone Receptor-Deoxyribonucleic Acid Complex: Novel Interactions Required for Binding to Half-Site Response Elements.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	S586 R593 R616 R623 K638
Binding residue (residue number reindexed from 1)	S24 R31 R54 R61 K76
Binding affinity	PDBbind-CN: Kd=133nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2c7a, PDBe:2c7a, PDBj:2c7a
PDBsum	2c7a
PubMed	16931575
UniProt	P06401\|PRGR_HUMAN Progesterone receptor (Gene Name=PGR)

[Back to BioLiP]