Structure of PDB 2c74 Chain B Binding Site BS01

Receptor Information
>2c74 Chain B (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKN
VVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVL
SLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASE
AAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAF
DDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c74 Structural basis for protein-protein interactions in the 14-3-3 protein family.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R57 R132 L177 N178 N229
Binding residue
(residue number reindexed from 1)		R56 R131 L176 N177 N228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0017080 sodium channel regulator activity
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0035259 nuclear glucocorticoid receptor binding
GO:0042802 identical protein binding
GO:0044325 transmembrane transporter binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002028 regulation of sodium ion transport
GO:0006713 glucocorticoid catabolic process
GO:0006886 intracellular protein transport
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0021762 substantia nigra development
GO:0042921 nuclear receptor-mediated glucocorticoid signaling pathway
GO:0045664 regulation of neuron differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0048167 regulation of synaptic plasticity
GO:0050774 negative regulation of dendrite morphogenesis
GO:0086010 membrane depolarization during action potential
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:2000649 regulation of sodium ion transmembrane transporter activity
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014704 intercalated disc
GO:0070062 extracellular exosome
GO:0098793 presynapse
GO:0098978 glutamatergic synapse
GO:0150048 cerebellar granule cell to Purkinje cell synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2c74, PDBe:2c74, PDBj:2c74
PDBsum2c74
PubMed17085597
UniProtQ04917|1433F_HUMAN 14-3-3 protein eta (Gene Name=YWHAH)

[Back to BioLiP]