Structure of PDB 2c6y Chain B Binding Site BS01

Receptor Information
>2c6y Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNS
IRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c6y Crystal Structure of the Human Foxk1A-DNA Complex and its Implications on the Diverse Binding Specificity of Winged Helix/Forkhead Proteins.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y8 R95
Binding residue
(residue number reindexed from 1)		Y8 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2c6y, PDBe:2c6y, PDBj:2c6y
PDBsum2c6y
PubMed16624804
UniProtQ01167|FOXK2_HUMAN Forkhead box protein K2 (Gene Name=FOXK2)

[Back to BioLiP]