Structure of PDB 2c62 Chain B Binding Site BS01

Receptor Information
>2c62 Chain B (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
QLKEQISDIDDAVRKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c62 A Global Transcription Cofactor Bound to Juxtaposed Strands of Unwound DNA
Resolution1.74 Å
Binding residue
(original residue number in PDB)
K68 R70 R75 F77 K80 L82 D84 R86 W89 K97 P98 G99 R100 K101 S104 N106
Binding residue
(residue number reindexed from 1)
K7 R9 R14 F16 K19 L21 D23 R25 W28 K36 P37 G38 R39 K40 S43 N45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0060261 positive regulation of transcription initiation by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2c62, PDBe:2c62, PDBj:2c62
PDBsum2c62
PubMed16415882
UniProtP53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 (Gene Name=SUB1)

[Back to BioLiP]