Structure of PDB 2c2z Chain B Binding Site BS01

Receptor Information

>2c2z Chain B (length=90) Species: 9606 (Homo sapiens)

TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDI
LTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD

Ligand information

>2c2z Chain C (length=5) Species: 32630 (synthetic construct)

tLETt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2c2z Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
• Resolution: 1.95 Å
• Binding residue (original residue number in PDB): S411 Y412 R413 N414 P415 A416 W420
• Binding residue (residue number reindexed from 1): S22 Y23 R24 N25 P26 A27 W31

Enzymatic activity

• Enzyme Commision number: 3.4.22.61: caspase-8.

Gene Ontology

Molecular Function

• GO:0004197 cysteine-type endopeptidase activity
• GO:0008234 cysteine-type peptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2c2z, PDBe:2c2z, PDBj:2c2z
• PDBsum: 2c2z
• PubMed: 16970398
• UniProt: Q14790|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)