Structure of PDB 2c2k Chain B Binding Site BS01

Receptor Information

>2c2k Chain B (length=103) Species: 9606 (Homo sapiens)

ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLK
QYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELY
FYH

Ligand information

>2c2k Chain C (length=5) Species: 32630 (synthetic construct)

tDEVa

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2c2k Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
• Resolution: 1.87 Å
• Binding residue (original residue number in PDB): Y204 S205 W206 R207 S209 S249
• Binding residue (residue number reindexed from 1): Y30 S31 W32 R33 S35 S75

Enzymatic activity

• Enzyme Commision number: 3.4.22.56: caspase-3.

Gene Ontology

Molecular Function

• GO:0004197 cysteine-type endopeptidase activity
• GO:0008234 cysteine-type peptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2c2k, PDBe:2c2k, PDBj:2c2k
• PDBsum: 2c2k
• PubMed: 16970398
• UniProt: P42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)