Structure of PDB 2bz8 Chain B Binding Site BS01

Receptor Information
>2bz8 Chain B (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDN
FVREIKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bz8 Cbl Promotes Clustering of Endocytic Adaptor Proteins
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F8 H14 D16 E17 G34 G35 W36 L47 N51 F52
Binding residue
(residue number reindexed from 1)
F7 H13 D15 E16 G33 G34 W35 L46 N50 F51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2bz8, PDBe:2bz8, PDBj:2bz8
PDBsum2bz8
PubMed16228008
UniProtQ96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 (Gene Name=SH3KBP1)

[Back to BioLiP]