Structure of PDB 2bp3 Chain B Binding Site BS01

Receptor Information
>2bp3 Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTD
NQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bp3 The Structure of the Gpib-Filamin a Complex.
Resolution2.32 Å
Binding residue
(original residue number in PDB)		E1895 G1896 G1897 L1898 S1899 L1900 A1901 I1902 E1903 G1904 P1905 S1906 K1907 A1908 I1910 Y1938 G1954
Binding residue
(residue number reindexed from 1)		E31 G32 G33 L34 S35 L36 A37 I38 E39 G40 P41 S42 K43 A44 I46 Y74 G90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bp3, PDBe:2bp3, PDBj:2bp3
PDBsum2bp3
PubMed16293600
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]