Structure of PDB 2bn3 Chain B Binding Site BS01

Receptor Information
>2bn3 Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bn3 Improving Radiation-Damage Substructures for Rip.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Binding residue
(residue number reindexed from 1)
V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:2bn3, PDBe:2bn3, PDBj:2bn3
PDBsum2bn3
PubMed16131756
UniProtP01317|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]