Structure of PDB 2b9s Chain B Binding Site BS01

Receptor Information
>2b9s Chain B (length=52) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENF
DF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2b9s The Structure of the Transition State of the Heterodimeric Topoisomerase I of Leishmania donovani as a Vanadate Complex with Nicked DNA.
Resolution2.27 Å
Binding residue
(original residue number in PDB)
N221 Y222
Binding residue
(residue number reindexed from 1)
N11 Y12
Enzymatic activity
Enzyme Commision number 5.99.1.2: Transferred entry: 5.6.2.1.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003917 DNA topoisomerase type I (single strand cut, ATP-independent) activity
Biological Process
GO:0006265 DNA topological change
Cellular Component
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2b9s, PDBe:2b9s, PDBj:2b9s
PDBsum2b9s
PubMed16487540
UniProtQ8WQM6

[Back to BioLiP]