Structure of PDB 2b3j Chain B Binding Site BS01

Receptor Information
>2b3j Chain B (length=151) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQP
TAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVY
GADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRA
N
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2b3j Crystal structure of Staphylococcus aureus tRNA adenosine deaminase TadA in complex with RNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R70 E72 R94 N123
Binding residue
(residue number reindexed from 1)		R70 E72 R94 N123
Enzymatic activity
Catalytic site (original residue number in PDB) H53 C83 C86
Catalytic site (residue number reindexed from 1) H53 C83 C86
Enzyme Commision number 3.5.4.33: tRNA(adenine(34)) deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008251 tRNA-specific adenosine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0052717 tRNA-specific adenosine-34 deaminase activity
Biological Process
GO:0002100 tRNA wobble adenosine to inosine editing
GO:0008033 tRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2b3j, PDBe:2b3j, PDBj:2b3j
PDBsum2b3j
PubMed16415880
UniProtQ99W51|TADA_STAAM tRNA-specific adenosine deaminase (Gene Name=tadA)

[Back to BioLiP]