Structure of PDB 2azx Chain B Binding Site BS01

Receptor Information
>2azx Chain B (length=388) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHF
LRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTK
WLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINK
TFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFP
AIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPK
PALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGR
DTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELK
KALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD
Ligand information
>2azx Chain D (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaccucguggcgcaaugguagcgcgucugacuccagaucagaagguugcg
uguucgaaucacgucgggguca
<.<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>.>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2azx Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N373 K374 F377 S378 G380 R381 D382 T383 I384 L426 T427 G428 K431
Binding residue
(residue number reindexed from 1)		N292 K293 F296 S297 G299 R300 D301 T302 I303 L345 T346 G347 K350
Enzymatic activity
Enzyme Commision number 6.1.1.2: tryptophan--tRNA ligase.
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004830 tryptophan-tRNA ligase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016874 ligase activity
GO:0019210 kinase inhibitor activity
GO:0019901 protein kinase binding
GO:0019904 protein domain specific binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0001525 angiogenesis
GO:0006412 translation
GO:0006418 tRNA aminoacylation for protein translation
GO:0006436 tryptophanyl-tRNA aminoacylation
GO:0006469 negative regulation of protein kinase activity
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0031334 positive regulation of protein-containing complex assembly
GO:0045765 regulation of angiogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2azx, PDBe:2azx, PDBj:2azx
PDBsum2azx
PubMed16724112
UniProtP23381|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic (Gene Name=WARS1)

[Back to BioLiP]