Structure of PDB 2awu Chain B Binding Site BS01

Receptor Information
>2awu Chain B (length=90) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQ
IGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2awu Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide
Resolution2.44 Å
Binding residue
(original residue number in PDB)
G328 L329 G330 F331 S332 I354
Binding residue
(residue number reindexed from 1)
G12 L13 G14 F15 S16 I38
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2awu, PDBe:2awu, PDBj:2awu
PDBsum2awu
PubMed17069616
UniProtQ62696|DLG1_RAT Disks large homolog 1 (Gene Name=Dlg1)

[Back to BioLiP]