Structure of PDB 2asu Chain B Binding Site BS01

Receptor Information
>2asu Chain B (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTG
YEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQR
VALICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECN
IKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNSWVLEGIIIPNR
VCARSRWPAVFTRVSVFVDWIHKVM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2asu Crystal structure of the beta-chain of human hepatocyte growth factor-like/macrophage stimulating protein.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		L586 C588 E603 W673
Binding residue
(residue number reindexed from 1)		L103 C105 E120 W190
Enzymatic activity
Catalytic site (original residue number in PDB) Q522 Q568 E658 G659 D660 Y661 G662
Catalytic site (residue number reindexed from 1) Q39 Q85 E175 G176 D177 Y178 G179
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2asu, PDBe:2asu, PDBj:2asu
PDBsum2asu
PubMed16279944
UniProtP26927|HGFL_HUMAN Hepatocyte growth factor-like protein (Gene Name=MST1)

[Back to BioLiP]