Structure of PDB 2ak5 Chain B Binding Site BS01

Receptor Information
>2ak5 Chain B (length=64) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRT
GWFPSNYVREIKPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ak5 Cbl promotes clustering of endocytic adaptor proteins.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
F15 D23 E24 G41 G42 W43 W54 N58 Y59
Binding residue
(residue number reindexed from 1)
F13 D21 E22 G39 G40 W41 W52 N56 Y57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ak5, PDBe:2ak5, PDBj:2ak5
PDBsum2ak5
PubMed16228008
UniProtO55043|ARHG7_RAT Rho guanine nucleotide exchange factor 7 (Gene Name=Arhgef7)

[Back to BioLiP]