Structure of PDB 2a7u Chain B Binding Site BS01

Receptor Information
>2a7u Chain B (length=105) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGA
LAPETLAESFIAVCGEQLDENGQNLIRVMAENGRLNALPDVLEQFIHLRA
VSEAT
Ligand information
>2a7u Chain A (length=22) Species: 83334 (Escherichia coli O157:H7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MQLNSTEISELIKQRIAQFNVV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2a7u Structural Characterization of the Interaction of the delta and alpha Subunits of the Escherichia coli F(1)F(0)-ATP Synthase by NMR Spectroscopy
ResolutionN/A
Binding residue
(original residue number in PDB)		F3 T5 V6 P9 Y10 A13 D16 F17 N71 N74 L75 V78
Binding residue
(residue number reindexed from 1)		F3 T5 V6 P9 Y10 A13 D16 F17 N71 N74 L75 V78
Enzymatic activity
Enzyme Commision number 3.6.3.14: Transferred entry: 7.1.2.2.
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2a7u, PDBe:2a7u, PDBj:2a7u
PDBsum2a7u
PubMed16128580
UniProtP0ABA5|ATPD_ECO57 ATP synthase subunit delta (Gene Name=atpH)

[Back to BioLiP]