Structure of PDB 1zr4 Chain B Binding Site BS01

Receptor Information
>1zr4 Chain B (length=182) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLL
RMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDS
YIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAV
LNMWQQGLGASHISKTMNIARSTVYKVINESN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zr4 Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		T126 G129 V138 F140 G141 R142 K145 S162 R172 Y176 N180
Binding residue
(residue number reindexed from 1)		T125 G128 V137 F139 G140 R141 K144 S161 R171 Y175 N179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zr4, PDBe:1zr4, PDBj:1zr4
PDBsum1zr4
PubMed15994378
UniProtP03012|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]