Structure of PDB 1ze2 Chain B Binding Site BS01

Receptor Information
>1ze2 Chain B (length=218) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGV
NQGTRILEFYKDLKKVYGEYDQVPPAYSAKKYKGERLYKLAREGKIINLP
PKRVKIFKIRVEVSPGTYIRVRESVGPHTIEESLNVFEAAPEEIENRIIP
LEKCLEWLPRVVVHQESTKMILNGSQIHLEMLKEWDGFKKGEVVRVFNEE
GRLLALAEAERNRKVFQT
Ligand information
>1ze2 Chain C (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccacgguucgaauccguggc
.<<<<<<<.......>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ze2 Conformational change of pseudouridine 55 synthase upon its association with RNA substrate
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R55 N244 G245 R303 K304 V305
Binding residue
(residue number reindexed from 1)		R55 N173 G174 R213 K214 V215
Enzymatic activity
Enzyme Commision number 5.4.99.25: tRNA pseudouridine(55) synthase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0140098 catalytic activity, acting on RNA
GO:0160148 tRNA pseudouridine(55) synthase activity
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031119 tRNA pseudouridine synthesis
GO:1990481 mRNA pseudouridine synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ze2, PDBe:1ze2, PDBj:1ze2
PDBsum1ze2
PubMed14990747
UniProtQ9WZW0|TRUB_THEMA tRNA pseudouridine synthase B (Gene Name=truB)

[Back to BioLiP]