Structure of PDB 1zbi Chain B Binding Site BS01

Receptor Information
>1zbi Chain B (length=136) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMG
EFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALI
WKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zbi Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		G73 S74 Q75 G76 N105 E109 N132 Q134 K180 T183
Binding residue
(residue number reindexed from 1)		G15 S16 Q17 G18 N47 E51 N74 Q76 K122 T125
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:1zbi, PDBe:1zbi, PDBj:1zbi
PDBsum1zbi
PubMed15989951
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]